.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k3i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structures of proteins VPA0419 from Vibrio parahaemolyticus and yiiS from Shigella flexneri provide structural coverage for protein domain family PFAM 04175. Proteins 78 779-784 2010
    Site NESGC
    PDB Id 2k3i Target Id SfR90
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS9133,15762, PF04175, 3.30.70.860 Molecular Weight 10745.54 Da.
    Residues 99 Isoelectric Point 4.55
    Sequence mkdvvdkcstkgcaidigtvidndnctskfsrffatreeaesfmtklkelaaaassadegasvaykikd legqveldaaftfscqaemiifelslrsla
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k3i
    1. SAM-T08, HMM-based protein structure prediction
    K Karplus - Nucleic acids research, 2009 - Oxford Univ Press
     
    2. Solution NMR structures of proteins VPA0419 from Vibrio parahaemolyticus and yiiS from Shigella flexneri provide structural coverage for protein domain family PFAM
    KK Singarapu, JL Mills, R Xiao, T Acton - Proteins: Structure, , 2010 - Wiley Online Library
     
    3. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch