.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k49

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of UPF0339 protein SO3888 from Shewanella oneidensis. To be Published
    Site NESGC
    PDB Id 2k49 Target Id SoR190
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9147,15791, BIG_655, PF07411, 3.30.160.160 Molecular Weight 12017.87 Da.
    Residues 110 Isoelectric Point 8.83
    Sequence msgwyelskssndqfkfvlkagngeviltselytgksgamngiesvqtnspiearyakevakndkpyfn lkaanhqiigtsqmysstaardngiksvmengktttikdlt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k49
    1. The other 90% of the protein: Assessment beyond the C_s for CASP8 template_based and high_accuracy models
    DA Keedy, CJ Williams, JJ Headd - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. A simple and efficient statistical potential for scoring ensembles of protein structures
    P Cossio, D Granata, A Laio, F Seno, A Trovato - Scientific Reports, 2012 - nature.com
     
    3. Determining Protein Structures from NOESY Distance Constraints by Semidefinite Programming
    B Alipanahi, N Krislock, A Ghodsi, H Wolkowicz - 2012 - hal.inria.fr
     
    4. Protein structure by semidefinite facial reduction
    B Alipanahi, N Krislock, A Ghodsi, H Wolkowicz - Research in , 2012 - Springer
     
    5. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch