.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k4n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution-State NMR Structure of protein PF0246 from Pyrococcus Furiosis. To be Published
    Site NESGC
    PDB Id 2k4n Target Id PfR75
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9021,15805 Molecular Weight 12370.57 Da.
    Residues 103 Isoelectric Point 4.75
    Sequence mnsevikefledigedyieleneihlkpevfyevwkyvgepelktyviedeivepgeydppemkytnvk kvkikkvyfetldnvrvvtdysefqkilkkrgtk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k4n
    1. The other 90% of the protein: Assessment beyond the C_s for CASP8 template_based and high_accuracy models
    DA Keedy, CJ Williams, JJ Headd - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. Assessment of CASP8 structure predictions for template free targets
    M Ben_David, O Noivirt_Brik, A Paz - Proteins: Structure, , 2009 - Wiley Online Library
     
    3. Modeling Disordered Regions in Proteins Using Rosetta
    RYR Wang, Y Han, K Krassovsky, W Sheffler, M Tyka - PloS one, 2011 - dx.plos.org
     
    4. Protein Structure Prediction Using Coarse Grain Force Fields
    N Mahmood, A Torda - 2010 - nasirmaan.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch