.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k4x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of 30S ribosomal protein S27A from Thermoplasma acidophilum/Northeast Structural Genomics Consortium Target TaT88/Ontario Center for Structural Proteomics target ta1093. To be Published
    Site NESGC
    PDB Id 2k4x Target Id TaT88
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS9218,15811, PF01599, 2.20.25.30, 2.10.50.10 Molecular Weight 6381.12 Da.
    Residues 55 Isoelectric Point 9.69
    Sequence mqkrelyeiadgklvrkhrfcprcgpgvflaehadryscgrcgytefkkakksks
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2k4x
    1. Improved sequence-based prediction of disordered regions with multilayer fusion of multiple information sources
    MJ Mizianty, W Stach, K Chen, KD Kedarisetti - , 2010 - Oxford Univ Press
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    3. Protein Structure Prediction Using Coarse Grain Force Fields
    N Mahmood, A Torda - 2010 - nasirmaan.com
     
    4. FunFOLDQA: A Quality Assessment Tool for Protein-Ligand Binding Site Residue Predictions
    DB Roche, MT Buenavista, LJ McGuffin - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch