.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k4y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of FeoA-like protein from Clostridium acetobutylicum: Northeast Structural Genomics Consortium Target CaR178. To be Published
    Site NESGC
    PDB Id 2k4y Target Id CaR178
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS8786,PF04023, 15812 Molecular Weight 8637.92 Da.
    Residues 78 Isoelectric Point 9.75
    Sequence mtkgiglneveikskvkvigivpeskvrrkimdmgivrgteiyiegkapmgdpialrlrgyslslrkse akdilvevl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k4y
    1. Structure of Stenotrophomonas maltophilia FeoA complexed with zinc: a unique prokaryotic SH3-domain protein that possibly acts as a bacterial ferrous iron-transport
    YC Su, KH Chin, HC Hung, GH Shen - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch