.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k53

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of A3DK08 protein from Clostridium thermocellum: Northeast Structural Genomics Consortium Target CmR9. To be Published
    Site NESGC
    PDB Id 2k53 Target Id CmR9
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS8798,15822, PF08984 Molecular Weight 7515.32 Da.
    Residues 68 Isoelectric Point 4.74
    Sequence mkitkdmiiadvlqmdrgtapifinngmhclgcpssmgesiedacavhgidadklvkelneyfekkev
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k53
    1. COMPASS server for homology detection: improved statistical accuracy, speed and functionality
    RI Sadreyev, M Tang, BH Kim - Nucleic acids research, 2009 - Oxford Univ Press
     
    2. Union of geometric constraint-based simulations with molecular dynamics for protein structure prediction
    TJ Glembo, SB Ozkan - Biophysical journal, 2010 - Elsevier
     
    3. Protein Structure Prediction Using Coarse Grain Force Fields
    N Mahmood, A Torda - 2010 - nasirmaan.com
     
    4. Rapid Computation of Protein NMR PropertiesAn Optimal Way to Chemical Shift Driven Protein Structure Refinement
    I JAKOVKIN, U STERNBERG, AS ULRICH - 2010 - wseas.us
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch