.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k54

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein ATC0727 from Agrobacterium Tumefaciens. To be Published
    Site NESGC
    PDB Id 2k54 Target Id AtT8
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8742,3.10.450.50, 15823 Molecular Weight 14059.24 Da.
    Residues 123 Isoelectric Point 4.92
    Sequence mnseielpvqkqleaynardidafmawwaddcqyyafpatllagnaaeirvrhierfkepdlygelltr vivgnvvidhetvtrnfpegkgevdvaciyevengriakawfkigeprivsqks
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k54
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    3. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch