The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Putative Lipoprotein from Pseudomonas syringae Gene Locus PSPTO2350. Northeast Structural Genomics Target PsR76A. To be Published
    Site NESGC
    PDB Id 2k57 Target Id PsR76A
    Molecular Characteristics
    Source Pseudomonas syringae
    Alias Ids TPS9038,, 15825, PF06004 Molecular Weight 6075.46 Da.
    Residues 53 Isoelectric Point 4.81
    Sequence masptvitlndgreiqavdtpkydedsgfyefkqldgkqtrinkdqvrtvkdl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2k57
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
    2. A Coarse-Grained Approach to Protein Design: Learning from Design to Understand Folding
    I Coluzza - PloS one, 2011 - dx.plos.org

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch