.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of PF0385. To be Published
    Site NESGC
    PDB Id 2k5c Target Id PfG1
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9013,1.10.287.510, 2.20.28.10, 3.30.50.10, 15828, 3.30.40.10, 3.30.160.60 Molecular Weight 13846.27 Da.
    Residues 116 Isoelectric Point 5.71
    Sequence ahhhhhhgsakcpicgsplkweelieemliienfeeivkdrerflaqveefvfkcpvcgeefygktlpr reaekvfellndfkggidwenkrvklklndllaletmleewdrrvkr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2k5c
    1. Assessment of CASP8 structure predictions for template free targets
    M Ben_David, O Noivirt_Brik, A Paz - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. Target domain definition and classification in CASP8
    ML Tress, I Ezkurdia - : Structure, Function, and , 2009 - Wiley Online Library
     
    3. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    4. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch