.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title SOLUTION NMR STRUCTURE OF SAG0934 from Streptococcus agalactiae. NORTHEAST STRUCTURAL GENOMICS TARGET SaR32[1-108]. To be Published
    Site NESGC
    PDB Id 2k5d Target Id SaR32
    Molecular Characteristics
    Source Streptococcus agalactiae
    Alias Ids TPS9118,15829, PF06125 Molecular Weight 14370.46 Da.
    Residues 128 Isoelectric Point 5.22
    Sequence mmrlangivldkdttfgelkfsalrrevriqnedgsvsdeikertydlkskgqgrmiqvsipasvplke fdynarvelinpiadtvatatyqgadvdwyikaddivltkdsssfkaqpqakkeptqdk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5d
    1. MOBI: a web server to define and visualize structural mobility in NMR protein ensembles
    AJM Martin, I Walsh, SCE Tosatto - Bioinformatics, 2010 - Oxford Univ Press
     
    2. Target domain definition and classification in CASP8
    ML Tress, I Ezkurdia - : Structure, Function, and , 2009 - Wiley Online Library
     
    3. Order and disorder in proteins
    A Ertekin - 2011 - mss3.libraries.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch