.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title SOLUTION STRUCTURE OF PUTATIVE UNCHARACTERIZED PROTEIN GSU1278 FROM METHANOCALDOCOCCUS JANNASCHII, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG) TARGET GsR195. To be Published
    Site NESGC
    PDB Id 2k5e Target Id GsR195
    Molecular Characteristics
    Source Geobacter sulfurreducens
    Alias Ids TPS8902,PF08984, 15833 Molecular Weight 6934.51 Da.
    Residues 65 Isoelectric Point 5.40
    Sequence mtqkftkdmtfaqalqthpgvagvlrsynlgcigcmgaqnesleqganahglnvedilrdlnala
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5e
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    2. COMPASS server for homology detection: improved statistical accuracy, speed and functionality
    RI Sadreyev, M Tang, BH Kim - Nucleic acids research, 2009 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch