.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of FeoA protein from Chlorobium tepidum. Northeast Structural Genomics Consortium target CtR121. To be Published
    Site NESGC
    PDB Id 2k5f Target Id CtR121
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS8803,15834, PF04023 Molecular Weight 10779.02 Da.
    Residues 97 Isoelectric Point 10.78
    Sequence mklselkagdraevtsvaaepavrrrlmdlglvrgaklkvlrfaplgdpievncngmlltmrrneaegi tvhilagdeghphgwpgfrrrhrfgkra
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5f
    1. Pressure-Dependent Structure Changes in Barnase on Ligand Binding Reveal Intermediate Rate Fluctuations
    DJ Wilton, R Kitahara, K Akasaka, MJ Pandya - Biophysical journal, 2009 - Elsevier
     
    2. Structure of Stenotrophomonas maltophilia FeoA complexed with zinc: a unique prokaryotic SH3-domain protein that possibly acts as a bacterial ferrous iron-transport
    YC Su, KH Chin, HC Hung, GH Shen - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch