The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of protein encoded by gene BPP1335 from Bordetella parapertussis: Northeast Structural Genomics Target BpR195. To be Published
    Site NESGC
    PDB Id 2k5g Target Id BpR195
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS8773,PF08327, 3.30.530.20, 15835 Molecular Weight 20070.61 Da.
    Residues 183 Isoelectric Point 6.15
    Sequence mtspssafpdghgarldaqsirferllpgpiervwawladadkrarwlaggelprqpgqtfelhfnhaa ltaetaparyaqydrpivarhtllrcepprvlaltwgggageapsevlfelseageqvrlvlthtrlad raamldvaggwhahlavlagklagqapppfwttlaqaeqdyeqrl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch