.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of protein encoded by MTH693 from Methanobacterium thermoautotrophicum: Northeast Structural Genomics Consortium target tt824a. To be Published
    Site NESGC
    PDB Id 2k5h Target Id TT824A
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9214,PF01957, 15836, 2.40.50.140 Molecular Weight 8074.86 Da.
    Residues 76 Isoelectric Point 6.54
    Sequence aaritgepskkavsdrligrkgvvmeaispqnsglvkvdgetwratsgtvldvgeevsvkaiegvklvv ekleeqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch