.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR chemical shift assignments of iron(ii) transport protein a from clostridium thermocellum , northeast structural genomics consortium (nesg) target vr131. To be Published
    Site NESGC
    PDB Id 2k5i Target Id VR131
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS9220,15837, PF04023 Molecular Weight 17178.06 Da.
    Residues 154 Isoelectric Point 8.68
    Sequence mklsrlvpgvparikrlevsgelheklvgmgfvpgeeieivqvaplgdpivckignrnitlrkreadli evevvggelpliladdgtyeitklnggrrflfrmknlgiesgkkiqvsgrryyiegreidlgygeatki wvrrvsdageeshpqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5i
    1. Structure of Stenotrophomonas maltophilia FeoA complexed with zinc: a unique prokaryotic SH3-domain protein that possibly acts as a bacterial ferrous iron-transport
    YC Su, KH Chin, HC Hung, GH Shen - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch