.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Protein FeoA from Clostridium thermocellum, Northeast Structural Genomics Consortium Target CmR17. To be Published
    Site NESGC
    PDB Id 2k5l Target Id CmR17
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS8797,PF04023, 15841 Molecular Weight 8162.28 Da.
    Residues 73 Isoelectric Point 9.62
    Sequence mfslrdakcgqtvkvvklhgtgalkrrimdmgitrgceiyirkvaplgdpiqinvrgyelslrksaaem ieve
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5l
    1. Structure of Stenotrophomonas maltophilia FeoA complexed with zinc: a unique prokaryotic SH3-domain protein that possibly acts as a bacterial ferrous iron-transport
    YC Su, KH Chin, HC Hung, GH Shen - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Improving protein secondary structure prediction using a multi-modal BP method
    W Qu, H Sui, B Yang, W Qian - Computers in biology and medicine, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch