.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution Structure of Membrane associated protein from Bacillus cereus: Northeast Structural Genomics Consortium Target: BcR97A. To be Published
    Site NESGC
    PDB Id 2k5q Target Id BcR97A
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8753,PF06486, 15846 Molecular Weight 11362.37 Da.
    Residues 97 Isoelectric Point 8.63
    Sequence mdlnrmgkdeyyvqitvdgkevhskadngqkykdyeykltgfdkdgkekeleftaqknlrkeaflrvyh sdkkgvsaweevkkdelpakvkeklgvk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5q
    1. The other 90% of the protein: Assessment beyond the C_s for CASP8 template_based and high_accuracy models
    DA Keedy, CJ Williams, JJ Headd - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. Analysis of CASP8 targets, predictions and assessment methods
    SY Shi, J Pei, RI Sadreyev, LN Kinch - Database: the journal , 2009 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch