.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of XF2673 from Xylella fastidiosa. Northeast Structural Genomics Consortium Target XfR39. To be Published
    Site NESGC
    PDB Id 2k5r Target Id XfR39
    Molecular Characteristics
    Source Xylella fastidiosa
    Alias Ids TPS9258,PF03966, 2.20.25.10, 15847 Molecular Weight 9887.80 Da.
    Residues 89 Isoelectric Point 6.06
    Sequence mdrkllhllcspdtrqplslleskglealnkaiasgtvqradgsiqnqslhealitrdrkqvfriedsi pvllpeeaiatiqianfpdk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5r
    1. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    2. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch