.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Putative N-Acetyl Transferase YhhK from E. coli Bound to Coenzyme A. To be Published
    Site NESGC
    PDB Id 2k5t Target Id ET106
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS14660,3.40.630.30, PF12568, 15848 Molecular Weight 14504.79 Da.
    Residues 127 Isoelectric Point 6.59
    Sequence mkltiirlekfsdqdridlqkiwpeyspsslqvddnhriyaarfnerllaavrvtlsgtegaldslrvr evtrrrgvgqylleevlrnnpgvscwwmadagvedrgvmtafmqalgftaqqggwekc
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands COA (COENZYME) x 1
    Metals

    Jmol

     
    Google Scholar output for 2k5t
    1. PanM, an Acetyl-Coenzyme A Sensor Required for Maturation of l-Aspartate Decarboxylase (PanD)
    TN Stuecker, AC Tucker, JC Escalante-Semerena - mBio, 2012 - Am Soc Microbiol
     
    2. An activator for pyruvoyl_dependent l_aspartate __decarboxylase is conserved in a small group of the __proteobacteria including Escherichia coli
    S Nozaki, ME Webb, H Niki - MicrobiologyOpen, 2012 - Wiley Online Library
     
    3. Formation of a heterooctameric complex between ADC and its cognate activating factor, PanZ, is CoA-dependent
    DCF Monteiro, MD Rugen, D Shepherd - Biochemical and , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch