.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Putative Lipoprotein from Bacillus cereus Ordered Locus BC_2438. Northeast Structural Genomics Target BcR103A. To be Published
    Site NESGC
    PDB Id 2k5w Target Id BcR103A
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8744,15850, PF06486 Molecular Weight 12825.86 Da.
    Residues 109 Isoelectric Point 8.67
    Sequence meraslnrigkdvyymqikgegtiekvdgrnlrnytlpaydedgvkkqitfrstkkendhklnkyaflr lyvdqddnskneissievksyeeiqkadlpekvkdkftik
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5w
    1. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    2. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     
    3. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    4. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch