.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k7i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein ATU0232 from Agrobacterium Tumefaciens. To be Published
    Site NESGC
    PDB Id 2k7i Target Id AtT3
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS24552,15916, 3.30.160.160, PF07411, BIG_655 Molecular Weight 6935.40 Da.
    Residues 62 Isoelectric Point 8.01
    Sequence mykfeiyqdkageyrfrfkasngetmfssegykakasaihaiesikrnsagadtvdlttmta
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k7i
    1. Simultaneous prediction of protein folding and docking at high resolution
    R Das, I Andr, Y Shen, Y Wu - Proceedings of the , 2009 - National Acad Sciences
     
    2. Determination of the structures of symmetric protein oligomers from NMR chemical shifts and residual dipolar couplings
    NG Sgourakis, OF Lange, F DiMaio - Journal of the , 2011 - ACS Publications
     
    3. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    4. Structure-oriented methods for protein NMR data analysis
    GA Bermejo, M Llins - Progress in nuclear magnetic resonance , 2010 - ncbi.nlm.nih.gov
     
    5. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch