.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k8e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein yegP from Escherichia Coli. To be Published
    Site NESGC
    PDB Id 2k8e Target Id ET102
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS24562,3.30.160.160, PF07411, BIG_655 Molecular Weight 13525.37 Da.
    Residues 123 Isoelectric Point 9.43
    Sequence mlfsihnfnqgvimagwfelskssdnqfrfvlkagngetiltselytsktsaekgiasvrsnspqeery ekktasngkfyfnlkaanhqiigssqmyataqsretgiasvkangtsqtvkdnt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k8e
    1. A Conversation on Protein Folding
    RH Sarma - Journal of Biomolecular Structure & Dynamics, 2011 - iitd.ac.in
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    3. Protein Structures-based Neighborhood Analysis vs Preferential Interactions Between the Special Pairs of Amino acids?
    J Wang, Z Cao, J Yu - Journal of Biomolecular Structure & Dynamics, 2011 - jbsdonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch