.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k8y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine. Mol.Cell 32 259-275 2008
    Site NESGC
    PDB Id 2k8y Target Id MjT1
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS28387,PF08617 Molecular Weight 16591.63 Da.
    Residues 145 Isoelectric Point 8.89
    Sequence miirgirgarinneifnlglkfqilnadvvatkkhvlhainqaktkkpiaksfwmeilvrasgqrqihe aikiigakdgnvclicedeetfrkiyeliggeiddsvleinedkerlireifkirgfgnvvervlekia lielkke
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k8y
    1. Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine
    DYL Mao, D Neculai, M Downey, S Orlicky, YZ Haffani - Molecular cell, 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch