The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein BPP2914 from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR206. To be Published
    Site NESGC
    PDB Id 2kat Target Id BpR206
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS27199,, 16030, Molecular Weight 12020.98 Da.
    Residues 107 Isoelectric Point 6.08
    Sequence mqamterleamlaqgtdnmllrftlgktyaeheqfdaalphlraaldfdptysvawkwlgktlqgqgdr agarqawesglaaaqsrgdqqvvkelqvflrrlareda
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch