.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kc7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Bacteroides fragilis protein BF1650. Northeast Structural Genomics Consortium target BfR218. To be Published
    Site NESGC
    PDB Id 2kc7 Target Id BfR218
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS27195,1.25.40.120, 16064, 1.10.150.160, PF00515, PF07719, 1.25.40.10 Molecular Weight 10577.45 Da.
    Residues 91 Isoelectric Point 4.53
    Sequence mdqlktikelinqgdienalqaleeflqtepvgkdeayylmgnayrklgdwqkalnnyqsaielnpdsp alqarkmvmdilnfynkdmynq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kc7
    1. Structure and RNA recognition by the snRNA and snoRNA transport factor PHAX
    A Mouro, A Varrot, CD Mackereth, S Cusack, M Sattler - Rna, 2010 - rnajournal.cshlp.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch