.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kcd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of SSP0047 from Staphylococcus saprophyticus. Northeast Structural Genomics Consortium Target SyR6. To be Published
    Site NESGC
    PDB Id 2kcd Target Id SyR6
    Molecular Characteristics
    Source Staphylococcus saprophyticus
    Alias Ids TPS27312,16072, PF06106 Molecular Weight 13315.50 Da.
    Residues 112 Isoelectric Point 4.70
    Sequence mtlelqlkhyitnlfnlprdekwecesieevaddilpdqyvrlgplsnkilqtntyysdtlhksniypf ilyyqkqliaigfidenhdmdflylhntvmplldqrylltggq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch