The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the Northeast Structural Genomics Target MrR121A. To be Published
    Site NESGC
    PDB Id 2kck Target Id MrR121A
    Molecular Characteristics
    Source Methanococcus maripaludis
    Alias Ids TPS27274,16083,,, PF00515, PF07719, Molecular Weight 12073.71 Da.
    Residues 103 Isoelectric Point 4.23
    Sequence vdqnpeeyylegvlqydagnytesidlfekaiqldpeeskywlmkgkalynleryeeavdcynyvinvi edeynkdvwaakadalryiegkeveaeiaearak
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch