.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kcm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the N-terminal OB-domain of SO_1732 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR210A. To be Published
    Site NESGC
    PDB Id 2kcm Target Id SoR210A
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS27297,2.40.50.140, PF00313, 16086 Molecular Weight 7200.99 Da.
    Residues 66 Isoelectric Point 8.93
    Sequence mkgkvvsylaakkygfiqgddgesyflhfselldkkdegklvkgsmvhfdptptpkglaakaislp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch