.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kcq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein SRU_2040 from Salinibacter ruber (strain DSM 13855). Northeast Structural Genomics Consortium target SrR106. To be Published
    Site NESGC
    PDB Id 2kcq Target Id SrR106
    Molecular Characteristics
    Source Salinibacter ruber dsm 13855
    Alias Ids TPS27299,3.40.140.10, 16093, PF01398 Molecular Weight 15995.58 Da.
    Residues 145 Isoelectric Point 4.76
    Sequence mkttpdildqirvhgadaypeegcgfllgtvtddgdnrvaalhratnrrseqrtrryeltaddyraada aaqeqgldvvgvyhshpdhparpsatdleeatfpgftyvivsvrdgapealtawalapdrsefhrediv rpdpeap
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kcq
    1. Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8
    SB Hong, BW Kim, KE Lee, SW Kim, H Jeon - Nature Structural & , 2011 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch