.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kct

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution nmr structure of the ob-fold domain of heme chaperoneccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. To be Published
    Site NESGC
    PDB Id 2kct Target Id DvR115G
    Molecular Characteristics
    Source Desulfovibrio vulgaris
    Alias Ids TPS27228,16096, 2.40.50.140, PF03100 Molecular Weight 9161.08 Da.
    Residues 85 Isoelectric Point 6.82
    Sequence atpqdklhtvrlfgtvaadgltmldgapgvrfrledkdntsktvwvlykgavpdtfkpgveviieggla pgedtfkartlmtkcp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kct
    1. c-Type cytochrome biogenesis can occur via a natural Ccm system lacking CcmH, CcmG, and the heme-binding histidine of CcmE
    AD Goddard, JM Stevens, F Rao, DAI Mavridou - Journal of Biological , 2010 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch