The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of O64736 protein from Arabidopsis thaliana. To be Published
    Site NESGC
    PDB Id 2kd0 Target Id AR3445A
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS27188,, PF00240, PF11976, 16101 Molecular Weight 7943.02 Da.
    Residues 75 Isoelectric Point 10.01
    Sequence stikltvkfggksiplsvspdctvkdlksqlqpitnvlprgqklifkgkvlvetstlkqsdvgsgaklm lmasqg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch