.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kd1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the Integrase-Like Domain from Bacillus cereus Ordered Locus BC_1272. Northeast Structural Genomics Consortium Target BcR268F. To be Published
    Site NESGC
    PDB Id 2kd1 Target Id BcR268F
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS27190,1.10.150.130, 16102 Molecular Weight 12345.69 Da.
    Residues 109 Isoelectric Point 9.70
    Sequence epsklsygeyleswfntkrhsvgiqtakvlkgylnsriipslgniklakltslhmqnyvnslrdeglkr gtiekiikvirnslehaidlelitknvaaktklpkadkee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch