.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kdb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2 (Herpud2 or Herp). To be Published
    Site NESGC
    PDB Id 2kdb Target Id HT53A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS27255,3.10.20.90, PF00240, 16109 Molecular Weight 10793.98 Da.
    Residues 94 Isoelectric Point 9.23
    Sequence mdqsgmeipvtliikapnqkysdqtiscflnwtvgklkthlsnvypskpltkdqrlvysgrllpdhlql kdilrkqdeyhmvhlvctsrtppss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kdb
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch