.
The Open Protein Structure Annotation Network
PDB Keyword
.

2keo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of human protein HS00059. To be Published
    Site NESGC
    PDB Id 2keo Target Id HT98A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS27257,3.10.120.10, 16155, PF00173 Molecular Weight 10214.75 Da.
    Residues 92 Isoelectric Point 4.06
    Sequence ekvtlvriadlenhnndggfwtvidgkvydikdfqtqsltensilaqfagedpvvaleaalqfedtres mhafcvgqylepdqegvtipdlg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2keo
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch