.
The Open Protein Structure Annotation Network
PDB Keyword
.

2key

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of a Domain from a Putative Phage Integrase Protein, BF2284, from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR257C. To be Published
    Site NESGC
    PDB Id 2key Target Id BfR257C
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS27197,1.10.150.130, 16161 Molecular Weight 12258.37 Da.
    Residues 103 Isoelectric Point 8.98
    Sequence nnpsdfksfhdfvasymktysrrleigtfrhhkscmrkfkeyceglqfheltedflrdyliymkktlcna dstaqrnlstikiyvsaaikkgymendpfkdfg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2key
    1. Curcumin suppresses proliferation and invasion in human gastric cancer cells by downregulation of PAK1 activity and cyclin D1 expression
    XZ Cai, J Wang, XD Li, GL Wang, FN Liu - Cancer Biol , 2009 - landesbioscience.com
     
    2. A review of advances in research on marine molluscan antimicrobial peptides and their potential application in aquaculture
    LI Cheng-Hua, Z Jian-Min, S Lin-Sheng - Molluscan Research, 2009 - books.google.com
     
    3. _______________________ 3 _____
    ___ ____ ____ ___ - Acta Phys. _ Chim. Sin, 2009 - whxb.pku.edu.cn
     
    4. Rediscovery of halogen bonds in protein-ligand complexes
    P Zhou, F Tian, J Zou, Z Shang - Mini Reviews in Medicinal , 2010 - ingentaconnect.com
     
    5. Molecular Modeling and Affinity Determination of scFv Antibody: Proper Linker Peptide Enhances Its Activity
    X Gu, X Jia, J Feng, B Shen, Y Huang, S Geng - Annals of biomedical , 2010 - Springer
     
    6. Reversible post-translational carboxylation modulates the enzymatic activity of N-acetyl-L-ornithine transcarbamylase
    Y Li, X Yu, J Ho, D Fushman, N Allewell - Biochemistry, 2010 - ACS Publications
     
    7. Predicting Protein-Ligand Binding Sites Based on an Improved Geometric Algorithm
    J He, DQ Wei, JF Wang, KC Chou - Protein and Peptide Letters, 2011 - ingentaconnect.com
     
    8. Hg1, a novel peptide inhibitor specific for Kv1. 3 channels from the first scorpion Kunitz-type potassium channel toxin family
    ZY Chen, YT Hu, WS Yang, YW He, J Feng - Journal of Biological , 2012 - ASBMB
     
    9. A new Pythium species isolated from vegetable fields and analysis by rDNA ITS sequence
    YY LONG, JG WEI, CL HUANG, YQ HE, GQ YUAN - ____, 2010 - journals.im.ac.cn
     
    10. Molecular dynamics simulations of CYP2E1
    J Li, DQ Wei, JF Wang, ZT Yu, KC Chou - Medicinal Chemistry, 2012 - ingentaconnect.com
     
    11. Analysis and Statistics of Crystallisation Success Increase by Composition Modification of Protein and Precipitant Mixing Ratio
    CY Zhang, M Mazumdar, DW Zhu - Protein and Peptide , 2011 - ingentaconnect.com
     
    12. Structure-guided activity restoration of the silkworm glutathione transferase Omega GSTO3-3
    BY Chen, XX Ma, PC Guo, X Tan, WF Li - Journal of molecular , 2011 - Elsevier
     
    13. Crystallization and Preliminary X-Ray Diffraction Analysis of ARO9, an Aromatic Aminotransferase from Saccharomyces cerevisiae
    H Chen, H Huang, X Li, S Tong, L Niu - Protein and Peptide , 2009 - ingentaconnect.com
     
    14. Identification and Sequence Analysis of UL34 Gene from Duck Plague Virus CHv Strain
    XR Zhong, AC Cheng, MS Wang - , 2009. BMEI'09. 2nd , 2009 - ieeexplore.ieee.org
     
    15. Electron transfers in proteins: Investigations with a modified through-bond coupling model
    YF Wang, G Yang, CB Liu - Physical Review E, 2009 - APS
     
    16. _________________ GSK-3_ _________
    ___ ____ ____ __ - ______, 2011 - whxb.pku.edu.cn
     
    17. Selection pressure drives the co-evolution of several lipid metabolism genes in mammals
    BF Lin, LH Yuan, JP Chen - Chinese Science Bulletin, 2012 - Springer
     
    18. of Neurological Disorder, from Molecular Neurobiology to Clinical Therapy
    Y Lu - 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch