.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kfp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of PSPTO_3016 from Pseudomonas syringae. Northeast Structural Genomics Consortium target PsR293. To be Published
    Site NESGC
    PDB Id 2kfp Target Id PsR293
    Related PDB Ids 3h9x 
    Molecular Characteristics
    Source Pseudomonas syringae
    Alias Ids TPS27282,PF04237, 16186 Molecular Weight 13736.06 Da.
    Residues 117 Isoelectric Point 6.97
    Sequence mnrqqfidyaqkkydtkpdhpwekfpdyavfrhsdndkwyallmdipaekigingdkrvdvidlkvqpe lvgslrkkpgiypayhmnkehwitvllngplgakeihsliedsfqltr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kfp
    1. Solution NMR and X-ray crystal structures of Pseudomonas syringae Pspto_3016 from protein domain family PF04237 (DUF419) adopt a double wing DNA binding
    EA Feldmann, J Seetharaman, TA Ramelot - Journal of structural and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch