.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kfv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the N-terminal domain of FK506-binding protein 3. To be Published
    Site NESGC
    PDB Id 2kfv Target Id HT99A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS28366, Molecular Weight 7969.75 Da.
    Residues 70 Isoelectric Point 9.10
    Sequence maaavpqrawtveqlrseqlpkkdiikflqehgsdsflaehkllgniknvaktankdhlvtaynhlfetk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kfv
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    2. Insights into immunophilin structure and function
    C Lucke, M Weiwad - Current medicinal chemistry, 2011 - ingentaconnect.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch