.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kgo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Zn-finger protein YBIL from E. coli. To be Published
    Site NESGC
    PDB Id 2kgo Target Id ET107
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS28332,PF01258 Molecular Weight 9755.26 Da.
    Residues 88 Isoelectric Point 5.11
    Sequence masgwanddavneqinstiedaiarargeiprgesldeceecgapipqarreaipgvrlcihcqqekdl qkpaytgynrrgskdsqlr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2kgo
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch