.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kgr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein ITSN1 from Homo sapiens. Northeast Structural Genomics Consortium target HR5524A. To be Published
    Site NESGC
    PDB Id 2kgr Target Id HR5524A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS27246,1.10.238.10 Molecular Weight 11530.67 Da.
    Residues 103 Isoelectric Point 7.41
    Sequence ppvaewavpqssrlkyrqlfnshdktmsghltgpqartilmqsslpqaqlasiwnlsdidqdgkltaee filamhlidvamsgqplppvlppeyippsfrrvr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kgr
    1. Characterization of enzymes involved in the central metabolism of Gluconobacter oxydans
    B Rauch, J Pahlke, P Schweiger - Applied microbiology and , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch