.
The Open Protein Structure Annotation Network
PDB Keyword
.

2khv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of protein Nmul_A0922 from Nitrosospira multiformis. Northeast Structural Genomics Consortium target NmR38B. To be Published
    Site NESGC
    PDB Id 2khv Target Id NmR38B
    Molecular Characteristics
    Source Nitrosospira multiformis
    Alias Ids TPS27278,16255, 1.10.150.130 Molecular Weight 11179.14 Da.
    Residues 97 Isoelectric Point 9.26
    Sequence tfsecaalyikahrsswkntkhadqwtntiktycgpvigplsvqdvdtklimkvldpiweqkpetasrl rgriesvldwatvrgyregdnparwrgy
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch