The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of tungsten formylmethanofuran dehydrogenase subunit D from Archaeoglobus fulgidus. To be Published
    Site NESGC
    PDB Id 2ki8 Target Id AtT7
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS28300,PF01568, Molecular Weight 13441.70 Da.
    Residues 122 Isoelectric Point 4.52
    Sequence mlevevisgrtlnqgatveeklteeyfnavnyaeineedwnalglqegdrvkvktefgevvvfakkgdv pkgmifipmgpyanmvidpstdgtgmpqfkgvkgtvektdekvlsvkelleai
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ki8
    1. Exploring the evolution of protein function in Archaea
    A Goncearenco, IN Berezovsky - BMC Evolutionary Biology, 2012 - biomedcentral.com

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch