.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kif

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of O6-alkylguanine recognition by a bacterial alkyltransferase-like DNA repair protein. J.Biol.Chem. 285 13736-13741 2010
    Site NESGC
    PDB Id 2kif Target Id VpR247
    Related PDB Ids 2kim 
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS28453,16283, PF01035, 16272, 1.10.10.10 Molecular Weight 11236.59 Da.
    Residues 100 Isoelectric Point 9.89
    Sequence mdqflvqifavihqipkgkvstygeiakmagypgyarhvgkalgnlpegsklpwfrvinsqgkislkgr dldrqkqkleaegvevseigkialrkykwqp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kif
    1. CASD-NMR: critical assessment of automated structure determination by NMR
    A Rosato, A Bagaria, D Baker, B Bardiaux, A Cavalli - Nature , 2009 - nature.com
     
    2. Structural basis of O6-alkylguanine recognition by a bacterial alkyltransferase-like DNA repair protein
    JM Aramini, JL Tubbs, S Kanugula, P Rossi - Journal of Biological , 2010 - ASBMB
     
    3. Alkyltransferase-like proteins: molecular switches between DNA repair pathways
    JL Tubbs, JA Tainer - Cellular and molecular life sciences, 2010 - Springer
     
    4. Blind testing of routine, fully automated determination of protein structures from NMR data
    A Rosato, JM Aramini, C Arrowsmith, A Bagaria - Structure, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch