.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kj6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of Tbulin folding Cofactor B obtained from Arabidopsis thaliana: Northeast. To be Published
    Site NESGC
    PDB Id 2kj6 Target Id AR3436A
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS28294,3.10.20.90, 16313 Molecular Weight 9596.24 Da.
    Residues 87 Isoelectric Point 5.37
    Sequence gddsvhlhithanlksfsadarfspqmsveavkeklwkkcgtsvnsmalelyddsgskvavlsddsrpl gffspfdgfrlhiidldp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kj6
    1. Blind testing of routine, fully automated determination of protein structures from NMR data
    A Rosato, JM Aramini, C Arrowsmith, A Bagaria - Structure, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch