.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kj8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of fragment 87-196 from the putative phage integrase IntS of E. coli. To be Published
    Site NESGC
    PDB Id 2kj8 Target Id ER652A
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS28326,16315, 1.10.150.130 Molecular Weight 12761.90 Da.
    Residues 110 Isoelectric Point 9.04
    Sequence ssnnnsfsaiykewyehkkqvwsvgyatelakmfdddilpiiggleiqdiepmqllevirrfedrgame rankarrrcgevfryaivtgrakynpapdladamkgyrkkn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch