The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Lkr136b. To be Published
    Site NESGC
    PDB Id 2kjk Target Id LkR136B
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS28372,PF00595, 13625, Molecular Weight 9861.69 Da.
    Residues 91 Isoelectric Point 5.88
    Sequence vkvtydgvyvlsvkedvpaagilhagdliteidgqsfkssqefidyihskkvgdtvkikykhgnkneea sikltaidkkgtpgigitlvdd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch