The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein ATC0852 from Agrobacterium tumefaciens. To be Published
    Site NESGC
    PDB Id 2kjz Target Id AtT2
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS28298,PF00903,, 16347 Molecular Weight 13246.26 Da.
    Residues 122 Isoelectric Point 5.19
    Sequence mthpdftilyvdnppastqfykallgvdpvessptfslfvlangmklglwsrhtvepkasvtggggela frvendaqvdetfagwkasgvamlqqpakmefgytftaadpdshrlrvyafag
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information


    Google Scholar output for 2kjz
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
    2. Structure-oriented methods for protein NMR data analysis
    GA Bermejo, M Llins - Progress in nuclear magnetic resonance , 2010 - ncbi.nlm.nih.gov
    3. Atomic resolution structure of EhpR: phenazine resistance in Enterobacter agglomerans Eh1087 follows principles of bleomycin/mitomycin C resistance in
    S Yu, A Vit, S Devenish, HK Mahanty - BMC structural , 2011 - biomedcentral.com
    4. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch