.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kk0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the ARID domain of human AT-rich interactive domain-containing protein 3A: a human cancer protein interaction network target. Proteins 78 2170-2175 2010
    Site NESGC
    PDB Id 2kk0 Target Id HR4394C
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS28353,PF01388, 16348, 1.10.150.60 Molecular Weight 15766.33 Da.
    Residues 134 Isoelectric Point 8.74
    Sequence pdhgdwtyeeqfkqlyeldgdpkrkeflddlfsfmqkrgtpvnripimakqvldlfmlyvlvtekgglv evinkklwreitkglnlptsitsaaftlrtqymkylypyecekrglsnpnelqaaidsnrregrr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kk0
    1. Solution NMR structure of the ARID domain of human AT_rich interactive domain_containing protein 3A: A human cancer protein interaction network target
    G Liu, YJ Huang, R Xiao, D Wang - Proteins: Structure, , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch