The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of F-actin-binding domain of Arg/Abl2 from Homo sapiens. Proteins 78 1326-1330 2010
    Site NESGC
    PDB Id 2kk1 Target Id HR5537A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS28360,PF08919, 16349, Molecular Weight 13331.43 Da.
    Residues 125 Isoelectric Point 5.34
    Sequence mangtagtkvalrktkqaaekisadkiskeallecadllssaltepvpnsqlvdtghqlldycsgyvdc ipqtrnkfafreavsklelslqelqvssaaagvpgtnpvlnnllscvqeisdvvqr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kk1
    1. Predicting protein structures with a multiplayer online game
    S Cooper, F Khatib, A Treuille, J Barbero, J Lee - Nature, 2010 - nature.com
    2. Blind testing of routine, fully automated determination of protein structures from NMR data
    A Rosato, JM Aramini, C Arrowsmith, A Bagaria - Structure, 2012 - Elsevier
    3. NMR structure of F_actin_binding domain of Arg/Abl2 from Homo sapiens
    G Liu, YJ Huang, R Xiao, D Wang - Proteins: Structure, , 2010 - Wiley Online Library

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch