.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kk4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of proterin AF2094 from Archaeoglobus fulgidus. To be Published
    Site NESGC
    PDB Id 2kk4 Target Id GT2
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS28342,16352 Molecular Weight 10246.08 Da.
    Residues 90 Isoelectric Point 4.50
    Sequence mdlicmyvfkgeesfgesidvygdylivkvgteflavpkksiksvedgrivigefdeeearelgrkwle ekskpvtleelksygfgeege
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch