.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kk6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d. To be Published
    Site NESGC
    PDB Id 2kk6 Target Id HR3461D
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS28351,3.30.505.10, 16353, PF00017 Molecular Weight 12251.46 Da.
    Residues 105 Isoelectric Point 9.16
    Sequence kplaeqdwyhgaiprieaqellkkqgdflvreshgkpgeyvlsvysdgqrrhfiiqyvdnmyrfegtgf snipqlidhhyttkqvitkksgvvllnpipkdkkwi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch